PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.042170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family NF-YB
Protein Properties Length: 111aa    MW: 12506.9 Da    PI: 4.626
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.042170.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB101.46.6e-322613695
           NF-YB 36 qecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
                     ecvse+isf+tsea+++cqre+rkt++++d+lwa+++lGf++y+epl+v+l++yre e+
  Cucsa.042170.1  2 LECVSEYISFITSEANERCQREQRKTVTAEDVLWAMGKLGFDNYIEPLTVFLNRYRESES 61
                    59*******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.4E-29164IPR009072Histone-fold
SuperFamilySSF471135.24E-23165IPR009072Histone-fold
PfamPF008082.2E-12137IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.2E-16119No hitNo description
PROSITE patternPS006850420IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.2E-162038No hitNo description
PRINTSPR006152.2E-163957No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 111 aa     Download sequence    Send to blast
MLECVSEYIS FITSEANERC QREQRKTVTA EDVLWAMGKL GFDNYIEPLT VFLNRYRESE  60
SIRTEPMLRR NVDYGPQVGM ISPYGQAFQI GHVPAGMFDA MGGYYGGGGS X
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4csr_A2e-233583994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B2e-233583994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818601e-122LN681860.1 Cucumis melo genomic scaffold, anchoredscaffold00021.
GenBankLN7132601e-122LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008449191.12e-66PREDICTED: nuclear transcription factor Y subunit B-9
SwissprotQ9SFD86e-35NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLA0A0A0L2U12e-66A0A0A0L2U1_CUCSA; Uncharacterized protein
STRINGVIT_00s0956g00020.t017e-39(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.18e-36NF-YB family protein